Recombinant Ustilago maydis P6 virus KP6 killer toxin, Unconjugated

Catalog Number: BIM-RPC25132
Article Name: Recombinant Ustilago maydis P6 virus KP6 killer toxin, Unconjugated
Biozol Catalog Number: BIM-RPC25132
Supplier Catalog Number: RPC25132
Alternative Catalog Number: BIM-RPC25132-20UG, BIM-RPC25132-100UG, BIM-RPC25132-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: KP6 killer toxin, Killer protein 6, Cleaved into: KP6 killer toxin subunit alpha, VP10, KP6 killer toxin subunit beta, VP12.5
Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ustilago maydis P6 virus (UmV6) (UmV-P6). Target Name: Ustilago maydis P6
Molecular Weight: 10.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
Target: Ustilago maydis P6 virus KP6 killer toxin