Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD), Unconjugated

Catalog Number: BIM-RPC25134
Article Name: Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD), Unconjugated
Biozol Catalog Number: BIM-RPC25134
Supplier Catalog Number: RPC25134
Alternative Catalog Number: BIM-RPC25134-20UG, BIM-RPC25134-100UG, BIM-RPC25134-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Type I DHQase
Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Salmonella typhi. Target Name: aroD. Target Synonyms: Type I DH
Molecular Weight: 29.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Target: aroD