Recombinant Human rhinovirus 1A Genome polyprotein, Unconjugated

Catalog Number: BIM-RPC25135
Article Name: Recombinant Human rhinovirus 1A Genome polyprotein, Unconjugated
Biozol Catalog Number: BIM-RPC25135
Supplier Catalog Number: RPC25135
Alternative Catalog Number: BIM-RPC25135-20UG, BIM-RPC25135-100UG, BIM-RPC25135-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Genome polyprotein, Cleaved into: P1, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2, P1B, Virion protein 2, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, P2, Protease 2A
Recombinant Human rhinovirus 1A Genome polyprotein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human rhinovirus 1A (HRV-1A). Target Name: Human rhinovirus 1A Genome polypro
Molecular Weight: 34.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPP
Target: Human rhinovirus 1A Genome polyprotein