Recombinant Ambrosia artemisiifolia Pectate lyase 5, Unconjugated

Catalog Number: BIM-RPC25142
Article Name: Recombinant Ambrosia artemisiifolia Pectate lyase 5, Unconjugated
Biozol Catalog Number: BIM-RPC25142
Supplier Catalog Number: RPC25142
Alternative Catalog Number: BIM-RPC25142-20UG, BIM-RPC25142-100UG, BIM-RPC25142-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Antigen Amb a IAntigen EAgEPollen allergen Amb a 1.1Allergen: Amb a 1.1
Recombinant Ambrosia artemisiifolia Pectate lyase 5 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ambrosia artemisiifolia (Short ragweed). Target Name: Ambrosia artemisiifoli
Molecular Weight: 41.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRH
Target: Ambrosia artemisiifolia Pectate lyase 5