Recombinant Salmonella typhimurium Protein PrgJ (prgJ), Unconjugated

Catalog Number: BIM-RPC25145
Article Name: Recombinant Salmonella typhimurium Protein PrgJ (prgJ), Unconjugated
Biozol Catalog Number: BIM-RPC25145
Supplier Catalog Number: RPC25145
Alternative Catalog Number: BIM-RPC25145-20UG, BIM-RPC25145-100UG, BIM-RPC25145-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: prgJ, STM2872Protein PrgJ
Recombinant Salmonella typhimurium Protein PrgJ (prgJ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Target Name
Molecular Weight: 14.4kDa
Tag: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Target: prgJ