Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated

Product Overview

• Article Name: Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated
• Biozol Catalog Number: BIM-RPC25148
• Supplier Catalog Number: RPC25148
• Alternative Catalog Number: BIM-RPC25148-20UG, BIM-RPC25148-100UG, BIM-RPC25148-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Conjugation: Unconjugated
• Alternative Names: Allergen Mal d IAllergen: Mal d 1

Product Description

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus). Target Name: MALD1. Target Syn

Product Properties

• Molecular Weight: 19.5kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
• Target: MALD1