Recombinant Streptomyces avidinii Streptavidin, Unconjugated

Catalog Number: BIM-RPC25151
Article Name: Recombinant Streptomyces avidinii Streptavidin, Unconjugated
Biozol Catalog Number: BIM-RPC25151
Supplier Catalog Number: RPC25151
Alternative Catalog Number: BIM-RPC25151-20UG, BIM-RPC25151-100UG, BIM-RPC25151-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Streptavidin
Recombinant Streptomyces avidinii Streptavidin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Streptomyces avidinii. Target Name: Streptomyces avidinii Streptavidin. Target Sy
Molecular Weight: 18.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Target: Streptomyces avidinii Streptavidin