Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla), Unconjugated

Product Overview

• Article Name: Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla), Unconjugated
• Biozol Catalog Number: BIM-RPC25154
• Supplier Catalog Number: RPC25154
• Alternative Catalog Number: BIM-RPC25154-20UG, BIM-RPC25154-100UG, BIM-RPC25154-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: E. coli
• Conjugation: Unconjugated
• Alternative Names: Beta-lactamase MEN-1Cefotaximase 1men1

Product Description

Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Escherichia coli. Target Name: bla. Target Synonyms: Beta-lactamase ME

Product Properties

• Molecular Weight: 30.2kDa
• Tag: C-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >85% as determined by SDS-PAGE
• Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLAS
• Target: bla