Recombinant Aspergillus niger 3-phytase A (phyA), Unconjugated

Catalog Number: BIM-RPC25158
Article Name: Recombinant Aspergillus niger 3-phytase A (phyA), Unconjugated
Biozol Catalog Number: BIM-RPC25158
Supplier Catalog Number: RPC25158
Alternative Catalog Number: BIM-RPC25158-20UG, BIM-RPC25158-100UG, BIM-RPC25158-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: 3 phytase AMyo-inositol hexakisphosphate phosphohydrolase AMyo-inositol-hexaphosphate 3-phosphohydrolase A
Recombinant Aspergillus niger 3-phytase A (phyA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aspergillus niger. Target Name: phyA. Target Synonyms: 3 phytase AMyo-inositol
Molecular Weight: 50.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTK
Target: phyA