Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial, Unconjugated

Catalog Number: BIM-RPC25160
Article Name: Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial, Unconjugated
Biozol Catalog Number: BIM-RPC25160
Supplier Catalog Number: RPC25160
Alternative Catalog Number: BIM-RPC25160-20UG, BIM-RPC25160-100UG, BIM-RPC25160-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Ly-6G.1
Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ly6g. Target Synonyms: Ly-6G.1. Acces
Molecular Weight: 25.9kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Target: Ly6g