Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1), Unconjugated

Catalog Number: BIM-RPC25173
Article Name: Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1), Unconjugated
Biozol Catalog Number: BIM-RPC25173
Supplier Catalog Number: RPC25173
Alternative Catalog Number: BIM-RPC25173-20UG, BIM-RPC25173-100UG, BIM-RPC25173-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: Nucleoside diphosphate kinase INDK INDP kinase INDPK I
Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: NDK
Molecular Weight: 20.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
Target: NDK1