Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod, Unconjugated

Product Overview

• Article Name: Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod, Unconjugated
• Biozol Catalog Number: BIM-RPC25176
• Supplier Catalog Number: RPC25176
• Alternative Catalog Number: BIM-RPC25176-20UG, BIM-RPC25176-100UG, BIM-RPC25176-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Reptile
• Conjugation: Unconjugated
• Alternative Names: Thrombin-like enzyme ancrod, SVTLE, EC 3.4.21.74, Fibrinogen-clotting enzyme, Snake venom serine protease, SVSP, Venombin A

Product Description

Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodost

Product Properties

• Molecular Weight: 28.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: VIGGDECNINEHRFLVAVYEGTNWTFICGGVLIHPEWVITAEHCARRRMNLVFGMHRKSEKFDDEQERYPKKRYFIRCNKTRTSWDEDIMLIRLNKPVNNSEHIAPLSLPSNPPIVGSDCRVMGWGSINRRIDVLSDEPRCANINLHNFTMCHGLFRKMPKKGRVLCAGDLRGRRDSCNSDSGGPLICNEELHGIVARGPNPCAQPNKPALYTSIYDYRDWVNNVIAGNATCSP
• Target: Calloselasma rhodostoma Thrombin-like enzyme ancrod