Recombinant Yersinia pestis F1 capsule antigen (caf1), Unconjugated

Catalog Number: BIM-RPC25177
Article Name: Recombinant Yersinia pestis F1 capsule antigen (caf1), Unconjugated
Biozol Catalog Number: BIM-RPC25177
Supplier Catalog Number: RPC25177
Alternative Catalog Number: BIM-RPC25177-20UG, BIM-RPC25177-100UG, BIM-RPC25177-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen
Recombinant Yersinia pestis F1 capsule antigen (caf1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Yersinia pestis. Target Name: caf1. Target Synonyms: caf1, YPMT1.84, Y1100
Molecular Weight: 17.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Target: caf1