Recombinant Lithobates catesbeiana Saxiphilin, Unconjugated

Catalog Number: BIM-RPC25178
Article Name: Recombinant Lithobates catesbeiana Saxiphilin, Unconjugated
Biozol Catalog Number: BIM-RPC25178
Supplier Catalog Number: RPC25178
Alternative Catalog Number: BIM-RPC25178-20UG, BIM-RPC25178-100UG, BIM-RPC25178-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Frog
Conjugation: Unconjugated
Alternative Names: SAX
Recombinant Lithobates catesbeiana Saxiphilin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: American bullfrog. Target Name: Lithobates catesbeiana Saxiphilin. Target Synonyms
Molecular Weight: 41.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYK
Target: Lithobates catesbeiana Saxiphilin