Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27), Unconjugated

Catalog Number: BIM-RPC25200
Article Name: Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27), Unconjugated
Biozol Catalog Number: BIM-RPC25200
Supplier Catalog Number: RPC25200
Alternative Catalog Number: BIM-RPC25200-20UG, BIM-RPC25200-100UG, BIM-RPC25200-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Phosphoprotein P41, PP41, Polymerase accessory protein, PAP
Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 varia
Molecular Weight: 46.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMR
Target: U27