Recombinant Centruroides noxius Beta-mammal toxin Cn2, Unconjugated

Catalog Number: BIM-RPC25213
Article Name: Recombinant Centruroides noxius Beta-mammal toxin Cn2, Unconjugated
Biozol Catalog Number: BIM-RPC25213
Supplier Catalog Number: RPC25213
Alternative Catalog Number: BIM-RPC25213-20UG, BIM-RPC25213-100UG, BIM-RPC25213-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Toxin II.9.2.2
Recombinant Centruroides noxius Beta-mammal toxin Cn2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Centruroides noxius (Mexican scorpion). Target Name: Centruroides noxius B
Molecular Weight: 9.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Target: Centruroides noxius Beta-mammal toxin Cn2