Recombinant Anemonia sulcata Delta-actitoxin-Avd1c, Unconjugated

Catalog Number: BIM-RPC25214
Article Name: Recombinant Anemonia sulcata Delta-actitoxin-Avd1c, Unconjugated
Biozol Catalog Number: BIM-RPC25214
Supplier Catalog Number: RPC25214
Alternative Catalog Number: BIM-RPC25214-20UG, BIM-RPC25214-100UG, BIM-RPC25214-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: ATX-II
Recombinant Anemonia sulcata Delta-actitoxin-Avd1c is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Anemonia sulcata (Mediterranean snakelocks sea anemone). Target Name: Anemoni
Molecular Weight: 6.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Target: Anemonia sulcata Delta-actitoxin-Avd1c