Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Unconjugated

Catalog Number: BIM-RPC25226
Article Name: Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Unconjugated
Biozol Catalog Number: BIM-RPC25226
Supplier Catalog Number: RPC25226
Alternative Catalog Number: BIM-RPC25226-20UG, BIM-RPC25226-100UG, BIM-RPC25226-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Islet-activating protein S1, IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)
Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13
Molecular Weight: 28.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Target: ptxA