Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), Unconjugated

Product Overview

• Article Name: Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), Unconjugated
• Biozol Catalog Number: BIM-RPC25231
• Supplier Catalog Number: RPC25231
• Alternative Catalog Number: BIM-RPC25231-20UG, BIM-RPC25231-100UG, BIM-RPC25231-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Conjugation: Unconjugated
• Alternative Names: L2, Minor capsid protein L2

Product Description

Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human papillomavirus type 18. Target Name: L2. Target Syno

Product Properties

• Molecular Weight: 51.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MVSHRAARRKRASVTDLYKTCKQSGTCPPDVVPKVEGTTLADKILQWSSLGIFLGGLGIGTGSGTGGRTGYIPLGGRSNTVVDVGPTRPPVVIEPVGPTDPSIVTLIEDSSVVTSGAPRPTFTGTSGFDITSAGTTTPAVLDITPSSTSVSISTTNFTNPAFSDPSIIEVPQTGEVAGNVFVGTPTSGTHGYEEIPLQTFASSGTGEEPISSTPLPTVRRVAGPRLYSRAYQQVSVANPEFLTRPSSLITYDNP
• Target: L2