Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2), Unconjugated

Product Overview

• Article Name: Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2), Unconjugated
• Biozol Catalog Number: BIM-RPC25236
• Supplier Catalog Number: RPC25236
• Alternative Catalog Number: BIM-RPC25236-20UG, BIM-RPC25236-100UG, BIM-RPC25236-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: Verocytotoxin 2 subunit B, Verotoxin 2 subunit B

Product Description

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Enterobacteria phage 933W (Bacteriophage 933W). Targe

Product Properties

• Molecular Weight: 9.8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
• Target: stxB2