Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB), Unconjugated

Product Overview

• Article Name: Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB), Unconjugated
• Biozol Catalog Number: BIM-RPC25240
• Supplier Catalog Number: RPC25240
• Alternative Catalog Number: BIM-RPC25240-20UG, BIM-RPC25240-100UG, BIM-RPC25240-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: H-gamma-1H-gamma-I

Product Description

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain N315). Target Name: hlgB. Tar

Product Properties

• Molecular Weight: 36.1kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQ
• Target: hlgB