Recombinant Staphylococcus aureus Enterotoxin type G (entG), Unconjugated

Catalog Number: BIM-RPC25241
Article Name: Recombinant Staphylococcus aureus Enterotoxin type G (entG), Unconjugated
Biozol Catalog Number: BIM-RPC25241
Supplier Catalog Number: RPC25241
Alternative Catalog Number: BIM-RPC25241-20UG, BIM-RPC25241-100UG, BIM-RPC25241-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: SEG
Recombinant Staphylococcus aureus Enterotoxin type G (entG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain N315). Target Name: entG. Target Synon
Molecular Weight: 29kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Target: entG