Recombinant Staphylococcus aureus Enterotoxin type B (entB), Unconjugated

Catalog Number: BIM-RPC25253
Article Name: Recombinant Staphylococcus aureus Enterotoxin type B (entB), Unconjugated
Biozol Catalog Number: BIM-RPC25253
Supplier Catalog Number: RPC25253
Alternative Catalog Number: BIM-RPC25253-20UG, BIM-RPC25253-100UG, BIM-RPC25253-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: SEB
Recombinant Staphylococcus aureus Enterotoxin type B (entB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: entB. Target Synonyms: SEB. Acce
Molecular Weight: 30.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Target: entB