Recombinant Human Interferon alpha-2 (IFNA2), Unconjugated

Product Overview

• Article Name: Recombinant Human Interferon alpha-2 (IFNA2), Unconjugated
• Biozol Catalog Number: BIM-RPC25254
• Supplier Catalog Number: RPC25254
• Alternative Catalog Number: BIM-RPC25254-20UG, BIM-RPC25254-100UG, BIM-RPC25254-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Interferon alpha-A, LeIF A

Product Description

Recombinant Human Interferon alpha-2 (IFNA2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IFNA2. Target Synonyms: Interferon alpha-A, LeIF

Product Properties

• Molecular Weight: 21.2kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Target: IFNA2