Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC26290
• Supplier Catalog Number: RPC26290
• Alternative Catalog Number: BIM-RPC26290-20UG, BIM-RPC26290-100UG, BIM-RPC26290-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: D16Ertd61e, Epitheliasin, FLJ41954, MGC6821, PP9284, PRSS10, Serine protease 10, TMPRSS2, TMPRSS2 ERG FUSION GENE, INCLUDED, TMPRSS2 ETV1 FUSION GENE, INCLUDED, TMPS2_HUMAN, Transmembrane protease serine 2 catalytic chain, Transmembrane protease, serine

Product Description

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: T

Product Properties

• Molecular Weight: 46.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
• Target: TMPRSS2