Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated

Catalog Number: BIM-RPC27164
Article Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated
Biozol Catalog Number: BIM-RPC27164
Supplier Catalog Number: RPC27164
Alternative Catalog Number: BIM-RPC27164-20UG, BIM-RPC27164-100UG, BIM-RPC27164-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Serine protease 10, PRSS10
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target
Molecular Weight: 47.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% as determined by SDS-PAGE
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Target: TMPRSS2