Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated, Unconjugated

Product Overview

• Article Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated, Unconjugated
• Biozol Catalog Number: BIM-RPC27187
• Supplier Catalog Number: RPC27187
• Alternative Catalog Number: BIM-RPC27187-20UG, BIM-RPC27187-100UG, BIM-RPC27187-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Serine protease 10

Product Description

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens).

Product Properties

• Molecular Weight: 90.6kDa
• Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >85% as determined by SDS-PAGE
• Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
• Target: TMPRSS2