Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated

Catalog Number: BIM-RPC28454
Article Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated
Biozol Catalog Number: BIM-RPC28454
Supplier Catalog Number: RPC28454
Alternative Catalog Number: BIM-RPC28454-20UG, BIM-RPC28454-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Serine protease 10
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target N
Molecular Weight: 46.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% as determined by SDS-PAGE
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Target: TMPRSS2