Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF

Catalog Number: BOB-PROTQ15109-2
Article Name: Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF
Biozol Catalog Number: BOB-PROTQ15109-2
Supplier Catalog Number: PROTQ15109-2
Alternative Catalog Number: BOB-PROTQ15109-2-5UG,BOB-PROTQ15109-2-20UG,BOB-PROTQ15109-2-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: advanced glycosylation end-product specific receptor, AGER, SCARJ1
Receptor for advanced glycation endproducts (RAGE) is a 35 kDa transmembrane receptor of the immunoglobulin super family. The mature RAGE has three main parts, consisting of extracellular, transmembrane, and cytosolic regions. A central mechanism by which ligand-RAGE interaction mediates cell stress and upregulates inflammatory pathways is via activation of signal transduction pathways.
Tag: His Tag (C-term)
UniProt: Q15109
Source: Escherichia coli
Purity: >98% as determined by SDS-PAGE.
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGV