Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF

Product Overview

• Article Name: Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF
• Biozol Catalog Number: BOB-PROTQ15109-2
• Supplier Catalog Number: PROTQ15109-2
• Alternative Catalog Number: BOB-PROTQ15109-2-5UG, BOB-PROTQ15109-2-20UG, BOB-PROTQ15109-2-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: advanced glycosylation end-product specific receptor, AGER, SCARJ1

Product Description

Receptor for advanced glycation endproducts (RAGE) is a 35 kDa transmembrane receptor of the immunoglobulin super family. The mature RAGE has three main parts, consisting of extracellular, transmembrane, and cytosolic regions. A central mechanism by whic

Product Properties

• Tag: His Tag (C-term)
• UniProt: Q15109
• Source: Escherichia coli
• Purity: >98% as determined by SDS-PAGE.
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDG