Human recombinant Sonic Hedgehog (C24II) protein, AF

Catalog Number: BOB-PROTQ15465-6
Article Name: Human recombinant Sonic Hedgehog (C24II) protein, AF
Biozol Catalog Number: BOB-PROTQ15465-6
Supplier Catalog Number: PROTQ15465-6
Alternative Catalog Number: BOB-PROTQ15465-6-5UG, BOB-PROTQ15465-6-20UG, BOB-PROTQ15465-6-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: SHH, TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Sonic hedgehog protein (SHH) plays a critical role in development of embryonic morphogenesis which mediate the process of organogenesis and central nervous system. The sonic hedgehog signal pathway also plays an important role in cancerous tumors like em
Tag: His-SUMO Tag (N-term)
UniProt: Q15465
Source: Escherichia coli
Purity: >95% as determined by SDS-PAGE.
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG