Human recombinant FGF-11 isoform 1 (Fibroblast growth factor-11 isoform 1) protein, AF

Product Overview

• Article Name: Human recombinant FGF-11 isoform 1 (Fibroblast growth factor-11 isoform 1) protein, AF
• Biozol Catalog Number: BOB-PROTQ92914
• Supplier Catalog Number: PROTQ92914
• Alternative Catalog Number: BOB-PROTQ92914-5UG, BOB-PROTQ92914-20UG, BOB-PROTQ92914-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: FHF-3, FHF3

Product Description

The Fibroblast Growth Factors (FGF) family has two group, secreted FGFs and intracellular FGFs (iFGFs). iFGFs are related to voltage-gated sodium (Nav) channels. Human FGF-11 isoform 1 is a 25 kDa cytokine with 225 amino acid residues.

Product Properties

• Tag: His Tag (C-term)
• UniProt: Q92914
• Source: Escherichia coli
• Purity: >98% as determined by SDS-PAGE.
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP with polyhistidine tag at th