Human recombinant FGF-14 (Fibroblast growth factor-14) protein, AF

Product Overview

• Article Name: Human recombinant FGF-14 (Fibroblast growth factor-14) protein, AF
• Biozol Catalog Number: BOB-PROTQ92915-2
• Supplier Catalog Number: PROTQ92915-2
• Alternative Catalog Number: BOB-PROTQ92915-2-5UG, BOB-PROTQ92915-2-20UG, BOB-PROTQ92915-2-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: FHF-4, FHF4, SCA27

Product Description

Fibroblast Growth Factors-14 (FGF-14) is a 27.7 kDa member of the fibroblast Growth Factors with 247 amino acid residues. FGF-14 is mainly expressed from brain, cervix. FGF-14 involved in nervous system development and function. May regulate voltage-gate

Product Properties

• Tag: His Tag (N-term)
• UniProt: Q92915
• Source: Escherichia coli
• Purity: >95% as determined by SDS-PAGE.
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT with pol