Recombinant Human FGF2 Protein

Product Overview

• Article Name: Recombinant Human FGF2 Protein
• Biozol Catalog Number: BOB-R00121
• Supplier Catalog Number: R00121
• Alternative Catalog Number: BOB-R00121-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Species Reactivity: Human

Product Description

Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging

Product Properties

• Molecular Weight: 16.5KD
• UniProt: P09038
• Buffer: Lyophilized after extensive dialysis against PBS.
• Source: E. Coli-derived P143-S288
• Purity: >95%, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining.
• Form: Lyophilized
• Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS