SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag
• Biozol Catalog Number: BOB-RCOV01
• Supplier Catalog Number: RCOV01
• Alternative Catalog Number: BOB-RCOV01-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Alternative Names: 2019-nCoV, COVID-19, NSP5A, Nonstructural Protein 5A, SARS-CoV-2, covid-19, sars-cov-2

Product Description

SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 34.6KD. This product is for research use only. Product is under validation for additional applications and indications. If youre interested, ple

Product Properties

• Molecular Weight: 34.6KD
• Buffer: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
• Source: E. coli
• Purity: > 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.Method of purification: Nickel column affinity purification
• Form: Lyophilized
• Sequence: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLS