Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody

Catalog Number: BVD-RD181247100
Article Name: Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody
Biozol Catalog Number: BVD-RD181247100
Supplier Catalog Number: RD181247100
Alternative Catalog Number: BVD-RD181247100-0.1
Manufacturer: BioVendor
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Alternative Names: FABP3, Fatty acid-binding protein 3, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP11
Polyclonal Antibody
Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody
Clonality: Polyclonal
Clone Designation: Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody
Isotype: IgG
Form: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequence: **MKHHHHHHAS**VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Storage: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target: Heart Fatty Acid Binding Protein
Notes: N
Application Dilute: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.