Regucalcin Human, Rabbit Polyclonal Antibody

Catalog Number: BVD-RD181257100
Article Name: Regucalcin Human, Rabbit Polyclonal Antibody
Biozol Catalog Number: BVD-RD181257100
Supplier Catalog Number: RD181257100
Alternative Catalog Number: BVD-RD181257100-0.1
Manufacturer: BioVendor
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Alternative Names: RC, Gluconolactonase, GNL, EC=3.1.1.17, Senescence marker protein 30, SMP-30, RGN
Polyclonal Antibody
Regucalcin Human, Rabbit Polyclonal Antibody
Clonality: Polyclonal
Clone Designation: Regucalcin Human, Rabbit Polyclonal Antibody
Form: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequence: **MKHHHHHHAS**MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKL
Storage: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target: Regucalcin
Application Dilute: Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.