Decorin Human, Rabbit Polyclonal Antibody

Catalog Number: BVD-RD181324100
Article Name: Decorin Human, Rabbit Polyclonal Antibody
Biozol Catalog Number: BVD-RD181324100
Supplier Catalog Number: RD181324100
Alternative Catalog Number: BVD-RD181324100-0.1
Manufacturer: BioVendor
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Alternative Names: Bone proteoglycan II, PG-S2, PG40, DCN, SLRR1B
Polyclonal Antibody
Decorin Human, Rabbit Polyclonal Antibody
Clonality: Polyclonal
Clone Designation: Decorin Human, Rabbit Polyclonal Antibody
Form: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequence: **MKHHHHHHAS**DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPH
Storage: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target: Decorin
Application Dilute: Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.