Apolipoprotein M Human, Sheep Polyclonal Antibody

Catalog Number: BVD-RD184129100
Article Name: Apolipoprotein M Human, Sheep Polyclonal Antibody
Biozol Catalog Number: BVD-RD184129100
Supplier Catalog Number: RD184129100
Alternative Catalog Number: BVD-RD184129100-0.1
Manufacturer: BioVendor
Host: Sheep
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Alternative Names: Apo M, Protein G3a, G3a, G3A, NG20
Polyclonal Antibody
Apolipoprotein M Human, Sheep Polyclonal Antibody
Clonality: Polyclonal
Clone Designation: Apolipoprotein M Human, Sheep Polyclonal Antibody
Form: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequence: **HVDYKDDDDKPAG**CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Storage: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target: Apolipoprotein M
Notes: This product is for research use only.
Application Dilute: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.