Granulysin Human, Sheep Polyclonal Antibody

Catalog Number: BVD-RD184327100
Article Name: Granulysin Human, Sheep Polyclonal Antibody
Biozol Catalog Number: BVD-RD184327100
Supplier Catalog Number: RD184327100
Alternative Catalog Number: BVD-RD184327100-0.1
Manufacturer: BioVendor
Host: Sheep
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Alternative Names: Lymphokine LAG-2, T-cell activation protein 519, GNLY, LAG2, NKG5, TLA519
Polyclonal Antibody
Granulysin Human, Sheep Polyclonal Antibody
Clonality: Polyclonal
Clone Designation: Granulysin Human, Sheep Polyclonal Antibody
Form: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequence: **MKHHHHHHAS**RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
Storage: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target: Granulysin
Application Dilute: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.