Procalcitonin Canine, Rabbit Polyclonal Antibody

Catalog Number: BVD-RD481488100
Article Name: Procalcitonin Canine, Rabbit Polyclonal Antibody
Biozol Catalog Number: BVD-RD481488100
Supplier Catalog Number: RD481488100
Alternative Catalog Number: BVD-RD481488100-0.1
Manufacturer: BioVendor
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Canine
Alternative Names: PCT
Polyclonal Antibody
Procalcitonin Canine, Rabbit Polyclonal Antibody
Clonality: Polyclonal
Clone Designation: Procalcitonin Canine, Rabbit Polyclonal Antibody
Isotype: IgG
Form: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequence: **MKHHHHHHAS**APFRSALEGLPDPTALSEKEGRLLLAALVKAYVQRKNELEQEQEQETEGSSLDSSRAKRCSNLSTCVLGTYSKDLNNFHTFSGIGFGAETPGKKRDIASGLERGR
Storage: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target: Procalcitonin
Notes: This product is for research use only.
Application Dilute: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.