RecombinantBDNF,Human

Product Overview

• Article Name: RecombinantBDNF,Human
• Biozol Catalog Number: BWT-BK0184
• Supplier Catalog Number: BK0184
• Alternative Catalog Number: BWT-BK0184-25UG,BWT-BK0184-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high

Product Properties

• Molecular Weight: 12-14kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.