RecombinantCINC-2alpha/CXCL3,Rat

Product Overview

• Article Name: RecombinantCINC-2alpha/CXCL3,Rat
• Biozol Catalog Number: BWT-BK0189
• Supplier Catalog Number: BK0189
• Alternative Catalog Number: BWT-BK0189-10UG,BWT-BK0189-1MG,BWT-BK0189-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2beta (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neu

Product Properties

• Molecular Weight: 7.6 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.