RecombinantCT-1,Human

Catalog Number: BWT-BK0191
Article Name: RecombinantCT-1,Human
Biozol Catalog Number: BWT-BK0191
Supplier Catalog Number: BK0191
Alternative Catalog Number: BWT-BK0191-10UG,BWT-BK0191-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biolo
Molecular Weight: 24~26kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.