RecombinantDCIP-1/CXCL3,Mouse

Product Overview

• Article Name: RecombinantDCIP-1/CXCL3,Mouse
• Biozol Catalog Number: BWT-BK0192
• Supplier Catalog Number: BK0192
• Alternative Catalog Number: BWT-BK0192-10UG,BWT-BK0192-1MG,BWT-BK0192-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect

Product Properties

• Molecular Weight: 8 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.