RecombinantEGF,Rat(CHO-expressed)

Catalog Number: BWT-BK0196
Article Name: RecombinantEGF,Rat(CHO-expressed)
Biozol Catalog Number: BWT-BK0196
Supplier Catalog Number: BK0196
Alternative Catalog Number: BWT-BK0196-10UG,BWT-BK0196-1MG,BWT-BK0196-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Recept
Molecular Weight: ~6 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.