RecombinantEpigen,Human(CHO-expressed)

Catalog Number: BWT-BK0197
Article Name: RecombinantEpigen,Human(CHO-expressed)
Biozol Catalog Number: BWT-BK0197
Supplier Catalog Number: BK0197
Alternative Catalog Number: BWT-BK0197-10UG,BWT-BK0197-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human
Molecular Weight: 15~20 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.