RecombinantFGF-16,Human

Product Overview

• Article Name: RecombinantFGF-16,Human
• Biozol Catalog Number: BWT-BK0199
• Supplier Catalog Number: BK0199
• Alternative Catalog Number: BWT-BK0199-10UG,BWT-BK0199-1MG,BWT-BK0199-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Fibroblast Growth Factor-16 (FGF-16) is a heparin binding growth factor, a member of the FGF family. All FGF family members are heparinbinding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF fam

Product Properties

• Molecular Weight: 23 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTV HGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQY YVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.