RecombinantFGF-21,His,Human

Product Overview

• Article Name: RecombinantFGF-21,His,Human
• Biozol Catalog Number: BWT-BK0200
• Supplier Catalog Number: BK0200
• Alternative Catalog Number: BWT-BK0200-10UG,BWT-BK0200-1MG,BWT-BK0200-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klot

Product Properties

• Molecular Weight: 23-25kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV GSSDPLSMVGPSQGRSPSYASHHHHHH
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.