RecombinantFGF-9,Mouse

Product Overview

• Article Name: RecombinantFGF-9,Mouse
• Biozol Catalog Number: BWT-BK0201
• Supplier Catalog Number: BK0201
• Alternative Catalog Number: BWT-BK0201-10UG,BWT-BK0201-1MG,BWT-BK0201-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Fibroblast Growth Factor-9 (FGF-9), also known as Glia-activating factor (GAF) and HBGF-9, belongs to the heparin-binding growth factors family. It is a secreted protein that exists as monomer or homodimer. It interacts with FGFR-1, FGFR-2, FGFR-3, and F

Product Properties

• Molecular Weight: ~28 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQ GTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYY VALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.