RecombinantFlt-3L,His,Mouse

Catalog Number: BWT-BK0202
Article Name: RecombinantFlt-3L,His,Mouse
Biozol Catalog Number: BWT-BK0202
Supplier Catalog Number: BK0202
Alternative Catalog Number: BWT-BK0202-10UG,BWT-BK0202-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Flt3L, also known as Fms-related tyrosine kinase 3 ligand and SL cytokine, is a single-pass type I membrane protein. It is expressed by stromal cells and T cells. Flt3L signals through tyrosine kinase receptor Flt3/Flk2 to stimulate the proliferation of
Molecular Weight: 24-30 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEI HFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPR PRHHHHHH
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.